Biotinylated Recombinant Human uPA/PLAU Protein
Product Sizes
100 ug
£657.00
RP00648B-100UG
500 ug
£1954.00
RP00648B-500UG
1000 ug
£3858.00
RP00648B-1000UG
About this Product
- SKU:
- RP00648B
- Additional Names:
- ATF|BDPLT5|PLAU|QPD|u-PA|UPA|URK|Urokinase
- Conjugate:
- Biotin
- Extra Details:
- Plasminogen activator, urokinase (uPA) is a secreted serine protease whose Dysregulation is often accompanied by various cancers. PLAU inhibition could suppress tumor growth. Collectively, PLAU is necessary for tumor progression and can be a diagnostic and prognostic biomarker in HNSCC.
- Formulation:
- Biotinylated Recombinant Human uPA/PLAU Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser21-Leu431) of Human uPA/PLAU (Accession #P00749-1) fuse
- Immunogen:
- Ser21-Leu431
- Molecular Weight:
- 24-26, 35-38, 52-60 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP00648B
