Recombinant Human/Mouse/Rat mature TGF-beta 3 Protein
Product Sizes
10 ug
£193.00
RP00645-10UG
20 ug
£258.00
RP00645-20UG
50 ug
£383.00
RP00645-50UG
100 ug
£586.00
RP00645-100UG
500 ug
£1716.00
RP00645-500UG
1000 ug
£2716.00
RP00645-1000UG
About this Product
- SKU:
- RP00645
- Additional Names:
- TGFB3,ARVD,ARVD1,LDS5,RNHF,TGF-beta3
- Extra Details:
- Transforming growth factor beta 3(TGFB3) is a member of a TGF - B Beta superfamily which is defined bytheirstructural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form ofTGFB3becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subsetofintegrins. It binds with high affinity to TGF- B Beta RII, a type II serine/threonine kinase receptor. TGFB3 is involvedincell differentiation, embryogenesis and development.It is believed to regulate molecules involved incellularadhesion and extracellular matrix (ECM) formation during the process of palate development. WithoutTGF-B Beta3,mammals develop a deformity known as a cleft palate.
- Formulation:
- Recombinant Human/Mouse/Rat TGF-beta 3 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala301-Ser412(Tyr340Phe)) of human TGF-beta 3/TGFB3 (Accessi
- Immunogen:
- Ala301-Ser412(Y340F)
- Molecular Weight:
- 13-16 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00645
