Recombinant Human/Mouse/Rat mature TGF-beta 3 Protein
Product Sizes
20 ug
£258.00
RP00645-20UG
50 ug
£383.00
RP00645-50UG
100 ug
£586.00
RP00645-100UG
About this Product
- SKU:
- RP00645
- Additional Names:
- TGFB3,ARVD,ARVD1,LDS5,RNHF,TGF-beta3
- Extra Details:
- Recombinant Human/Mouse/Rat TGF-beta 3 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala301-Ser412(Tyr340Phe)) of human TGF-beta 3/TGFB3 (Accession #P10600).
- Formulation:
- Lyophilized from a 0.2 um filtered solution of 50mM Glycine-HCl, 150mM NaCl, pH 2.5. Contact us for customized product form or formulation.
- Immunogen:
- Ala301-Ser412(Y340F)
- Molecular Weight:
- 12.70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00645








