Recombinant Mouse Apolipoprotein E/APOE Protein
Product Sizes
10 ug
£145.00
RP00640-10UG
20 ug
£193.00
RP00640-20UG
50 ug
£288.00
RP00640-50UG
100 ug
£431.00
RP00640-100UG
500 ug
£1240.00
RP00640-500UG
1000 ug
£1954.00
RP00640-1000UG
About this Product
- SKU:
- RP00640
- Additional Names:
- APOE,AD2,APO-E,ApoE4,LDLCQ5,LPG,AI255918,Apo-E,Apoe
- Extra Details:
- Apolipoprotein E (Apo-E), is a member of the apolipoprotein A1/A4/E family. ApoE is a major proteincomponent of serum LDL, VLDL, HDL, and chylomicrons. APOE may function in mediating the binding,internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptorand for the specific apo-E receptor (chylomicron remnant) of hepatic tissues. APOE is usually secreted inplasma. Phosphorylation sites are present in the extracellular medium.
- Formulation:
- Recombinant Mouse ApoE/APOE/Apolipoprotein E Protein is produced by Human cells expression system. The target protein is expressed with sequence (Glu19-Gln311) of mouse ApoE/APOE/Apolipoprotein E (Acc
- Immunogen:
- Glu19-Gln311
- Molecular Weight:
- 35-45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00640
