Recombinant Mouse Apolipoprotein E/APOE Protein
Product Sizes
10 ug
£145.00
RP00640-10UG
20 ug
£193.00
RP00640-20UG
50 ug
£288.00
RP00640-50UG
100 ug
£431.00
RP00640-100UG
About this Product
- SKU:
- RP00640
- Additional Names:
- APOE,AD2,APO-E,ApoE4,LDLCQ5,LPG,AI255918,Apo-E,Apoe
- Extra Details:
- Recombinant Mouse ApoE/APOE/Apolipoprotein E Protein is produced by Human cells expression system. The target protein is expressed with sequence (Glu19-Gln311) of mouse ApoE/APOE/Apolipoprotein E (Accession #P08226) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Glu19-Gln311
- Molecular Weight:
- 34.81 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00640








