Biotinylated Recombinant Human B7-H3/CD276 Protein

Product Sizes

100 ug

£657.00

RP00637B-100UG

500 ug

£1954.00

RP00637B-500UG

1000 ug

£3382.00

RP00637B-1000UG

About this Product

SKU:: RP00637B
Additional Names:: B7 homolog 3|B7-H3|B7H3|CD276|PRO352|PSEC0249|UNQ309
Conjugate:: Biotin
Extra Details:: B7-H3, a member of the B7 family of immunomodulatory molecules, is overexpressed in a wide range of solid cancers.B7-H3 binds to activated T cells via an as yet unidentified receptor. In assays using sub-optimal amount so anti-CD3 stimulation, 2Ig?B7?H3 enhances T cell proliferation, T cell interferon-gamma (IFN-gamma) production, and cytotoxic T cells induction.
Formulation:: Biotinylated Recombinant Human B7-H3/CD276 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu29-Pro245) of Human B7-H3/CD276 (Accession #Q5ZPR3-2
Immunogen:: Leu29-Pro245
Molecular Weight:: 40-50 kDa
Physical State:: Lyophilized
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Sequence:: LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein

Basket