Recombinant Human B7-H3/CD276 Protein
Product Sizes
100 ug
£353.00
RP00635-100UG
500 ug
£1002.00
RP00635-500UG
1000 ug
£1954.00
RP00635-1000UG
About this Product
- SKU:
- RP00635
- Additional Names:
- B7 homolog 3|B7-H3|B7H3|CD276|PRO352|PSEC0249|UNQ309
- Extra Details:
- B7-H3, a member of the B7 family of immunomodulatory molecules, is overexpressed in a wide range of solid cancers.B7-H3 binds to activated T cells via an as yet unidentified receptor. In assays using sub-optimal amount so anti-CD3 stimulation, 2Ig?B7?H3 enhances T cell proliferation, T cell interferon-gamma (IFN-gamma) production, and cytotoxic T cells induction.
- Formulation:
- Recombinant Human B7-H3/CD276 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu29-Pro245) of Human B7-H3/CD276 (Accession #Q5ZPR3-2) fused with
- Immunogen:
- Leu29-Pro245
- Molecular Weight:
- 60-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00635
