Recombinant Human IL-23A&Mouse IL-12B Protein
Product Sizes
100 ug
£586.00
RP00632-100UG
500 ug
£1716.00
RP00632-500UG
1000 ug
£3382.00
RP00632-1000UG
About this Product
- SKU:
- RP00632
- Additional Names:
- IL12 beta|IL12 B Beta|IL23 alpha|IL23 alpha&IL12 beta|IL23 alpha&IL12 B Beta
- Extra Details:
- Interleukin (IL)-12 and IL-23 belong to the IL-12 type family and are composite cytokines, consisting of the common B Beta subunit p40 and the specific cytokine A Alpha subunit p35 and p19, respectively. IL-12 signals via the IL-12RB Beta1 IL-12RB Beta2 receptor complex, and IL-23 uses also IL-12RB Beta1 but engages IL-23R as second receptor.
- Formulation:
- Recombinant Human IL-23A&Mouse IL-12B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg20-Pro189(Human IL-23 alpha) & Met23-Ser335(Mouse IL-12 b
- Immunogen:
- Arg20-Pro189(Human IL-23 alpha) & Met23-Ser335(Mouse IL-12 beta)
- Molecular Weight:
- 22 kDa (Human IL-23 alpha), 45-60 kDa (Mouse IL-12 beta)
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSPMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00632
