Recombinant Human CD3E&CD3D Protein

Product Sizes

100 ug

£431.00

RP00624-100UG

500 ug

£1240.00

RP00624-500UG

1000 ug

£2716.00

RP00624-1000UG

About this Product

SKU:: RP00624
Additional Names:: CD3|CD3 delta&CD3 epsilon|CD3d|CD3e|CD3E&CD3D|T3D
Extra Details:: T-cell surface glycoprotein CD3 epsilon & CD3 delta chain, also known as CD3E & CD3D , are single-pass type I membrane proteins.When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain.
Formulation:: Recombinant Human CD3E&CD3D/CD3 epsilon&CD3 delta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp23-Asp126(CD3E) & Phe22-Ala105(CD3D)) of Huma
Immunogen:: Asp23-Asp126(CD3E) & Phe22-Ala105(CD3D)
Molecular Weight:: 48-58 kDa (CD3E) , 42-48 kDa (CD3D)
Physical State:: Lyophilized
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Sequence:: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket