Recombinant Human CD3E&CD3D Protein
Product Sizes
100 ug
£508.00
RP00623-100UG
About this Product
- SKU:
- RP00623
- Additional Names:
- CD3|CD3 delta&CD3 epsilon|CD3d|CD3e|CD3E&CD3D|T3D
- Extra Details:
- Recombinant Human CD3E&CD3D/CD3 epsilon&CD3 delta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp23-Glu120(CD3E) & Phe22-Ala105(CD3D)) of Human CD3E&CD3D/CD3 epsilon&CD3 delta (Accession #P07766(CD3E)&P04234(CD3D)) fused with a C-His tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Asp23-Glu120(CD3E) & Phe22-Ala105(CD3D)
- Molecular Weight:
- 17.9 kDa (CD3E), 16.7 kDa (CD3D)
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCEFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00623
