Recombinant Mouse IL-33 Protein
Product Sizes
10 ug
£145.00
RP00618-10UG
20 ug
£193.00
RP00618-20UG
50 ug
£288.00
RP00618-50UG
100 ug
£431.00
RP00618-100UG
500 ug
£1240.00
RP00618-500UG
1000 ug
£1954.00
RP00618-1000UG
About this Product
- SKU:
- RP00618
- Additional Names:
- Il33, Il1f11, NF-HEV, 9230117N10Rik,IL-33
- Extra Details:
- Mouse Interleukin 33 (IL-33) is a proinflammatory cytokine which may also regulates gene transcription inproducer cells. IL-33 is structurally related to IL-1, which induces helper T cells to produce type 2 cytokines andacts through the receptor IL1RL-1. BindingIL-33 to this receptor activates NF-kappa-B and MAP kinases andinduces in vitro Th2 cells to produce cytokines. In vivo, IL-33 induces the expression of IL-4, IL-5, IL-13 and alsoleads to severe pathological changes in mucosal organs.
- Formulation:
- Recombinant Mouse IL-33 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser109-Ile266) of mouse IL-33 (Accession #Q8BVZ5) fused with an initial Met at
- Immunogen:
- Ser109-Ile266
- Molecular Weight:
- 18 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00618
