Recombinant Mouse IL-33 Protein
Product Sizes
10 ug
£145.00
RP00618-10UG
20 ug
£193.00
RP00618-20UG
50 ug
£288.00
RP00618-50UG
100 ug
£431.00
RP00618-100UG
About this Product
- SKU:
- RP00618
- Additional Names:
- Il33, Il1f11, NF-HEV, 9230117N10Rik,IL-33
- Extra Details:
- Recombinant Mouse IL-33 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser109-Ile266) of mouse IL-33 (Accession #Q8BVZ5) fused with an initial Met at the N-terminus.
- Formulation:
- Lyophilized from a 0.2 uM filtered solution of 20mM PB,150mM NaCl,pH7.4Contact us for customized product form or formulation.
- Immunogen:
- Ser109-Ile266
- Molecular Weight:
- 17.6 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00618
