Biotinylated Recombinant Human TNFRSF17/BCMA/CD269 Trimer Protein
Product Sizes
100 ug
£657.00
RP00617B-100UG
About this Product
- SKU:
- RP00617B
- Additional Names:
- BCM|BCMA|CD269|TNFRSF13A|TNFRSF17
- Conjugate:
- Biotin
- Extra Details:
- Biotinylated Recombinant Human TNFRSF17/BCMA/CD269 Trimer Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Ala54) of Human TNFRSF17/BCMA/CD269 Trimer (Accession #Q02223) fused with a C-His&Avi tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Met1-Ala54
- Molecular Weight:
- 29.5 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE.≥ 95 %
- Sequence:
- MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Manufacturer's Data Sheet:RP00617B
