Biotinylated Recombinant Human TNFRSF17/BCMA/CD269 Protein
Product Sizes
100 ug
£657.00
RP00612B-100UG
500 ug
£1954.00
RP00612B-500UG
1000 ug
£3858.00
RP00612B-1000UG
About this Product
- SKU:
- RP00612B
- Additional Names:
- BCM|BCMA|CD269|TNFRSF13A|TNFRSF17
- Conjugate:
- Biotin
- Extra Details:
- B-cell maturation antigen (BCMA or BCM), also known as tumor necrosis factor receptor superfamily member 17 (TNFRSF17), is a protein that in humans is encoded by the TNFRSF17 gene.TNFRSF17 is a cell surface receptor of the TNF receptor superfamily which recognizes B-cell activating factor (BAFF).
- Formulation:
- Biotinylated Recombinant Human TNFRSF17/BCMA/CD269 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Ala54) of Human TNFRSF17/BCMA/CD269 (Acces
- Immunogen:
- Met1-Ala54
- Molecular Weight:
- 12, 15-17 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Manufacturer's Data Sheet:RP00612B
