Recombinant Human Transcriptional Repressor Ctcf/CTCF Protein
Product Sizes
10 ug
£193.00
RP00606-10UG
50 ug
£478.00
RP00606-50UG
About this Product
- SKU:
- RP00606
- Additional Names:
- CTCF, MRD21, CCCTC-binding factor,MRD21,CTCF
- Extra Details:
- Recombinant Human Transcriptional Repressor Ctcf/CTCF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ile154) of Human Transcriptional Repressor Ctcf/CTCF (Accession #P49711)fused with no tag.
- Formulation:
- Lyophilized from a 0.2 uM filtered solution of PBS, pH 7.4Contact us for customized product form or formulation.
- Immunogen:
- Met1-Ile154
- Molecular Weight:
- 16.9 kda
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00606
