Recombinant Human CD3 epsilon Protein
Product Sizes
100 ug
£395.00
RP00601-100UG
About this Product
- SKU:
- RP00601
- Additional Names:
- CD3-epsilon|CD3e|FLJ18683|IMD18|T3E|TCRE
- Extra Details:
- Recombinant Human CD3 epsilon Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp23-Asp126) of Human CD3 epsilon (Accession #P07766) fused with a C-hFc tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Asp23-Asp126(C119S, C122S)
- Molecular Weight:
- 36.1 kda
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVSENSMEMD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00601
