Recombinant Human CD8 alpha Protein
Product Sizes
100 ug
£431.00
RP00586-100UG
About this Product
- SKU:
- RP00586
- Additional Names:
- CD8|CD8a|CD8a molecule|Leu2|Lyt-2|MAL|OKT8 T-cell antigen|p32
- Extra Details:
- Recombinant Human CD8 alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser22-Asp182) of Human CD8 alpha (Accession #P01732-1) fused with a C-His tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Ser22-Asp182
- Molecular Weight:
- 18.70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00586
