Recombinant Human CD8 alpha Protein
Product Sizes
100 ug
£431.00
RP00586-100UG
500 ug
£1240.00
RP00586-500UG
1000 ug
£2430.00
RP00586-1000UG
About this Product
- SKU:
- RP00586
- Additional Names:
- CD8|CD8a|CD8a molecule|Leu2|Lyt-2|MAL|OKT8 T-cell antigen|p32
- Extra Details:
- CD8 alpha enhances the responses of antigen-specific CTL activated through TCR through binding MHC class I, favoring lipid raft partitioning of TCR, and inducing intracellular signaling. CD8 alpha is also found on dendritic cells and rat macrophages, but whether CD8 alpha enhances responses of a partner receptor, like TCR, to activate these cells is not known.
- Formulation:
- Recombinant Human CD8 alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser22-Asp182) of Human CD8 alpha (Accession #P01732-1) fused with a C-
- Immunogen:
- Ser22-Asp182
- Molecular Weight:
- 28-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00586
