Recombinant Human CD3E&CD3G Protein
Product Sizes
100 ug
£508.00
RP00582-100UG
About this Product
- SKU:
- RP00582
- Additional Names:
- CD3|CD3 epsilon&CD3 gamma|CD3e|CD3E&CD3G|CD3G|T3G
- Extra Details:
- Recombinant Human CD3E&CD3G/CD3 epsilon&CD3 gamma Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp23-Asp126(CD3E) & Gln23-Ser116(CD3G)) of Human CD3E&CD3G/CD3 epsilon&CD3 gamma (Accession #P07766(CD3E)&P09693(CD3G)) fused with a C-hFc tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Asp23-Asp126(CD3E) & Gln23-Ser116(CD3G)
- Molecular Weight:
- 37.8 kDa (CD3E) , 36.5 kDa (CD3G)
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00582
