Biotinylated Recombinant Human/Cynomolgus/Rhesus macaque CD28 Protein
Product Sizes
100 ug
£657.00
RP00575B-100UG
About this Product
- SKU:
- RP00575B
- Additional Names:
- CD28|CD28 antigen|CD28 antigen (Tp44)|CD28 molecule|MGC138290|T-cell-specific surface glycoprotein CD28|Tp44
- Conjugate:
- Biotin
- Extra Details:
- Biotinylated Recombinant Human/Cynomolgus/Rhesus macaque CD28 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn19-Pro152) of Human/Cynomolgus/Rhesus-macaque CD28 (Accession #P10747) fused with a N-His&Avi tag at the N-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Asn19-Pro152
- Molecular Weight:
- 18.2 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Manufacturer's Data Sheet:RP00575B
