Recombinant Mouse CSF-3/G-CSF Protein
Product Sizes
10 ug
£145.00
RP00573-10UG
20 ug
£193.00
RP00573-20UG
50 ug
£288.00
RP00573-50UG
100 ug
£431.00
RP00573-100UG
About this Product
- SKU:
- RP00573
- Additional Names:
- Csf3|G-CSF,GCSF|Granulocyte colony-stimulating factor
- Extra Details:
- Recombinant Mouse CSF-3/G-CSF Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Met1-Ala208) of mouse G-CSF/CSF3 (Accession #P09920) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Ala208
- Molecular Weight:
- 19.79 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00573








