Recombinant Human/Cynomolgus/Rhesus macaque CD28 Protein
Product Sizes
100 ug
£336.00
RP00569-100UG
500 ug
£1002.00
RP00569-500UG
1000 ug
£1764.00
RP00569-1000UG
About this Product
- SKU:
- RP00569
- Additional Names:
- CD28|CD28 antigen|CD28 antigen (Tp44)|CD28 molecule|MGC138290|T-cell-specific surface glycoprotein CD28|Tp44
- Extra Details:
- CD28 is the receptor for CD80 (B7-1) and CD86 (B7-2) proteins.When activated by Toll-like receptor ligands, the CD80 expression is upregulated in antigen presenting cells (APCs). The CD86 expression on antigen presenting cells is constitutive. CD28 is the only B7 receptor constitutively expressed on naive T cells.
- Formulation:
- Recombinant Human/Cynomolgus/Rhesus macaque CD28 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn19-Pro152) of Human/Cynomolgus/Rhesus-macaque
- Immunogen:
- Asn19-Pro152
- Molecular Weight:
- 65-68 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00569
