Recombinant Human BY55/CD160 Protein
Product Sizes
10 ug
£127.00
RP00566-10UG
20 ug
£175.00
RP00566-20UG
50 ug
£240.00
RP00566-50UG
100 ug
£336.00
RP00566-100UG
About this Product
- SKU:
- RP00566
- Additional Names:
- CD160,BY55,NK1,NK28
- Extra Details:
- Recombinant Human CD160 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ile27-Ser159) of human CD160 (Accession #O95971) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS,pH7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ile27-Ser159
- Molecular Weight:
- 15.64 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00566
