Biotinylated Recombinant Human B7-2/CD86 Protein

Product Sizes

100 ug

£657.00

RP00561B-100UG

500 ug

£1954.00

RP00561B-500UG

1000 ug

£3382.00

RP00561B-1000UG

About this Product

SKU:: RP00561B
Additional Names:: 4-1BB Ligand|4-1BBL|41BB Ligand|CD137L|TNFSF9
Conjugate:: Biotin
Extra Details:: B7-1 and B7-2 are homologous costimulatory ligands expressed on the surface of antigen presenting cells (APCs). Binding of these molecules to the T cell costimulatory receptors, CD28 and CTLA-4, is essential for the activation and regulation of T cell immunity. B7-1 and B7-2 do not form hetero-oligomers, underscoring the biological relevance of dimeric and monomeric state of B7-1 and B7-2, respectively.
Formulation:: Biotinylated Recombinant Human B7-2/CD86 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu26-Pro247) of Human B7-2/CD86 (Accession #P42081-1) fu
Immunogen:: Leu26-Pro247
Molecular Weight:: 55-70 kDa
Physical State:: Lyophilized
Purity:: ≥95%
Sequence:: LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket