Recombinant Human B7-2/CD86 Protein
Product Sizes
100 ug
£336.00
RP00559-100UG
500 ug
£907.00
RP00559-500UG
1000 ug
£1574.00
RP00559-1000UG
About this Product
- SKU:
- RP00559
- Additional Names:
- 4-1BB Ligand|4-1BBL|41BB Ligand|CD137L|TNFSF9
- Extra Details:
- B7-1 and B7-2 are homologous costimulatory ligands expressed on the surface of antigen presenting cells (APCs). Binding of these molecules to the T cell costimulatory receptors, CD28 and CTLA-4, is essential for the activation and regulation of T cell immunity. B7-1 and B7-2 do not form hetero-oligomers, underscoring the biological relevance of dimeric and monomeric state of B7-1 and B7-2, respectively.
- Formulation:
- Recombinant Human B7-2/CD86 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu26-Pro247) of Human B7-2/CD86 (Accession #P42081-1) fused with a C-
- Immunogen:
- Leu26-Pro247
- Molecular Weight:
- 75-90 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00559
