Recombinant Human Siglec-3/CD33 Protein
Product Sizes
100 ug
£336.00
RP00555-100UG
About this Product
- SKU:
- RP00555
- Additional Names:
- CD33|CD33 molecule|FLJ00391|gp67|p67|Siglec-3|Siglec3
- Extra Details:
- Recombinant Human Siglec-3/CD33 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp18-His259) of Human Siglec-3/CD33 (Accession #P20138-1) fused with a C-His&Avi tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in 20 mM MES, 500 mM NaCl, 200 mM L-Arginine (pH 5.0). Normally 8% mannitol is added as protectant before lyophilization.
- Immunogen:
- Asp18-His259
- Molecular Weight:
- 29.6 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00555
