Recombinant Human Siglec-3/CD33 Protein
Product Sizes
100 ug
£336.00
RP00555-100UG
500 ug
£1002.00
RP00555-500UG
1000 ug
£1764.00
RP00555-1000UG
About this Product
- SKU:
- RP00555
- Additional Names:
- CD33|CD33 molecule|FLJ00391|gp67|p67|Siglec-3|Siglec3
- Extra Details:
- Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state.They are sialoadhesin/CD169/Siglec-1, CD22/Siglec-2, CD33/Siglec-3, Myelin-Associated Glycoprotein (MAG/Siglec-4a) and Siglecs 5 to 11. To date, no Siglec has been shown to recognized any cell surface ligand other than sialic acids, suggesting that interactions with glycans containing this carbohydrate are important in mediating the biological functions of Siglecs.
- Formulation:
- Recombinant Human Siglec-3/CD33 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp18-His259) of Human Siglec-3/CD33 (Accession #P20138-1) fused w
- Immunogen:
- Asp18-His259
- Molecular Weight:
- 52-60 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00555
