Biotinylated Recombinant Human B7-H3 (4Ig)/B7-H3b/CD276 Protein
Product Sizes
100 ug
£657.00
RP00546B-100UG
500 ug
£1954.00
RP00546B-500UG
1000 ug
£3382.00
RP00546B-1000UG
About this Product
- SKU:
- RP00546B
- Additional Names:
- 4Ig-B7-H3|B7 homolog 3|B7-H3|CD276|PRO352|PSEC0249|UNQ309
- Conjugate:
- Biotin
- Extra Details:
- B7-H3, a member of the B7 family of immunomodulatory molecules, is overexpressed in a wide range of solid cancers.B7-H3 binds to activated T cells via an as yet unidentified receptor. In assays using sub-optimal amount so anti-CD3 stimulation, 2Ig?B7?H3 enhances T cell proliferation, T cell interferon-gamma (IFN-gamma) production, and cytotoxic T cells induction.
- Formulation:
- Biotinylated Recombinant Human B7-H3 (4Ig) /B7-H3b/CD276 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly27-Thr461) of HumanB7-H3 (4Ig) /B7-H3b
- Immunogen:
- Gly27-Thr461
- Molecular Weight:
- 70-80 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- GALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Manufacturer's Data Sheet:RP00546B
