Recombinant Human TNFRSF5/CD40 Protein
Product Sizes
100 ug
£336.00
RP00542-100UG
500 ug
£1002.00
RP00542-500UG
1000 ug
£1764.00
RP00542-1000UG
About this Product
- SKU:
- RP00542
- Additional Names:
- CD40|CD40 antigen|CD40 molecule|CD40L receptor|CDw40|MGC9013|TNFRSF5
- Extra Details:
- CD40 is a costimulatory protein found on antigen presenting cells and is required for their activation. The binding of CD154 (CD40L) on TH cells to CD40 activates antigen presenting cells and induces a variety of downstream effects.CD40 molecule is a potential target for cancer immunotherapy. There are number of completed and ongoing clinical trials where agonistic anti-CD40 monoclonal antibodies are employed to activate an anti-tumor T cell response via activation of dendritic cells.
- Formulation:
- Recombinant Human TNFRSF5/CD40 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu21-Arg193) of Human TNFRSF5/CD40 (Accession #P25942-1) fused wit
- Immunogen:
- Glu21-Arg193
- Molecular Weight:
- 55-65 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00542
