Recombinant Human BST-1/CD157 Protein
Product Sizes
20 ug
£175.00
RP00541-20UG
50 ug
£240.00
RP00541-50UG
100 ug
£336.00
RP00541-100UG
About this Product
- SKU:
- RP00541
- Additional Names:
- BST1,CD157
- Extra Details:
- Recombinant Human BST-1/CD157 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gly29-Lys292) of human CD157/BST1/ADP-ribosyl cyclase 2/Cyclic ADP-ribose hydrolase 2 (Accession #Q10588) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gly29-Lys292
- Molecular Weight:
- 29.95 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP00541
