Recombinant Human IFN-alpha 6 Protein
Product Sizes
50 ug
£288.00
RP00540-50UG
100 ug
£431.00
RP00540-100UG
About this Product
- SKU:
- RP00540
- Additional Names:
- IFNA6,IFN-alphaK
- Extra Details:
- Recombinant Human IFN-alpha 6 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ser21-Glu189) of human IFNA6/IFN-alpha 6/LeIF K (Accession #P05013) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ser21-Glu189
- Molecular Weight:
- 20.90 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00540
