Recombinant Human IL-20RA Protein
Product Sizes
10 ug
£145.00
RP00537-10UG
50 ug
£336.00
RP00537-50UG
500 ug
£2050.00
RP00537-500UG
1000 ug
£2430.00
RP00537-1000UG
About this Product
- SKU:
- RP00537
- Additional Names:
- IL20RA,CRF2-8,IL-20R-alpha,IL-20R1,IL-20RA
- Extra Details:
- Interleukin-20 Receptor Subunit A Alpha (IL20RA) is a single-pass type I membrane protein that is a member of thetype II cytokine receptor family. IL20RA is synthetized a 553 amino acid glycoprotein precursor containing a 29amino acid signal peptide, a 221 amino acid extracellular domain with two fibronectin type-III domains, a 24amino acid transmembrane region, and a 279 amino acid intracellular domain. IL20RA is widely expressed withhighest levels found in skin and testis and high levels in brain. IL20RA forms a heterodimer with IL20RB, andthe complex serves as a receptor for IL19, IL20 and IL24. IL20RA also forms a heterodimer with the unique andspecific receptor IL10RB and functions as the receptor for IL26.
- Formulation:
- Recombinant Human IL-20RA/IL-20 R alpha Protein is produced by Human cells expression system. The target protein is expressed with sequence (Val30-Lys250) of human IL-20RA/IL-20 R alpha (Accession #Q9
- Immunogen:
- Val30-Lys250
- Molecular Weight:
- 60 kda
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00537
