Biotinylated Recombinant Human CD47 Protein
Product Sizes
100 ug
£657.00
RP00530B-100UG
500 ug
£1954.00
RP00530B-500UG
1000 ug
£3382.00
RP00530B-1000UG
About this Product
- SKU:
- RP00530B
- Additional Names:
- CD47|CD47 glycoprotein|CD47 molecule|IAP|MER6|OA3
- Conjugate:
- Biotin
- Extra Details:
- CD47 (Cluster of Differentiation 47) also known as integrin associated protein (IAP) is a transmembrane protein that in humans is encoded by the CD47 gene. CD47 belongs to the immunoglobulin superfamily and partners with membrane integrins and also binds the ligands thrombospondin-1 (TSP-1) and signal-regulatory protein alpha (SIRPA Alpha).CD-47 acts as a don't eat me signal to macrophages of the immune system which has made it a potential therapeutic target in some cancers.
- Formulation:
- Biotinylated Recombinant Human CD47 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (GIn19-Pro139) of Human CD47 (Accession #Q08722-1) fused with a
- Immunogen:
- GIn19-Pro139
- Molecular Weight:
- 42-52 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00530B
