Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein
Product Sizes
100 ug
£395.00
RP00527-100UG
About this Product
- SKU:
- RP00527
- Additional Names:
- ?Ki-24 antigen|CD27 Ligand|CD27-L|CD27LG|CD70|CD70 molecule|TNFSF7|TNFSF7G
- Extra Details:
- Recombinant Human CD27 Ligand/CD70 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln39-Pro193) of Human TNFSF7/CD27 Ligand/CD70 (Accession #P32970-1) fused with tag at the N-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Gln39-Pro193
- Molecular Weight:
- 42.7 kda
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- LESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00527
