Biotinylated Recombinant Human TNFSF7/CD27 Ligand/CD70 Trimer Protein (Primary Amine Labeling)
Product Sizes
100 ug
£657.00
RP00526B-100UG
500 ug
£1954.00
RP00526B-500UG
1000 ug
£3382.00
RP00526B-1000UG
About this Product
- SKU:
- RP00526B
- Additional Names:
- ?Ki-24 antigen|CD27 Ligand|CD27-L|CD27LG|CD70|CD70 molecule|TNFSF7|TNFSF7G
- Conjugate:
- Biotin
- Extra Details:
- CD70, also named CD27 ligand (CD27L), is a type II transmembrane glycoprotein belonging to the TNF superfamily (TNFSF) and has been designated TNFSF7.? CD70 is a cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
- Formulation:
- Biotinylated Recombinant Human TNFSF7/CD27 Ligand/CD70 Trimer Protein (Primary Amine Labeling) is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu50-Pro19
- Immunogen:
- Leu50-Pro193
- Molecular Weight:
- 55-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- LESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Manufacturer's Data Sheet:RP00526B
