Biotinylated Recombinant Human B29/CD79B Protein
Product Sizes
100 ug
£657.00
RP00524B-100UG
500 ug
£1954.00
RP00524B-500UG
1000 ug
£3382.00
RP00524B-1000UG
About this Product
- SKU:
- RP00524B
- Additional Names:
- B29|CD79B|CD79b molecule|Ig-beta|Ig-B Beta|IGB|IGBAGM6
- Conjugate:
- Biotin
- Extra Details:
- CD79B (also known as B29, Ig beta and B cell antigen receptor complex-associated protein beta-chain) is a 36-40 kDa member of the Ig-Superfamily. It is required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation.
- Formulation:
- Biotinylated Recombinant Human CD79B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala29-Asp159) of Human CD79B (Accession #P40259-1) fused with
- Immunogen:
- Ala29-Asp159
- Molecular Weight:
- 35-45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Manufacturer's Data Sheet:RP00524B
