Recombinant Human CEACAM5/CEA/CD66e (501-685) Protein
Product Sizes
100 ug
£431.00
RP00520-100UG
About this Product
- SKU:
- RP00520
- Additional Names:
- Carcinoembryonic|CD66e|CEA|CEACAM-5|CEACD66e
- Extra Details:
- Recombinant Human CEACAM5/CEA/CD66e (501-685) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro501-Ala685) of Human CEACAM5/CD66e (501-685) (Accession #P06731-1) fused with a C-His tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Pro501-Ala685
- Molecular Weight:
- 20.89 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- PKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00520




