Recombinant Human CEACAM5/CEA/CD66e (501-685) Protein

Product Sizes

100 ug

£431.00

RP00520-100UG

500 ug

£1240.00

RP00520-500UG

1000 ug

£2430.00

RP00520-1000UG

About this Product

SKU:: RP00520
Additional Names:: Carcinoembryonic|CD66e|CEA|CEACAM-5|CEACD66e
Extra Details:: Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5) was identified as a metastatic driver. CEACAM5 overproduction enriched for an epithelial gene expression pattern and facilitated tumor outgrowth at metastatic sites. Tissues from patients with metastatic breast cancer confirmed elevated levels of CEACAM5 in lung metastases relative to breast tumors, and an inverse correlation between CEACAM5 and the mesenchymal marker vimentin was demonstrated.
Formulation:: Recombinant Human CEACAM5/CEA/CD66e (501-685) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro501-Ala685) of Human CEACAM5/CD66e (501-685) (Acc
Immunogen:: Pro501-Ala685
Molecular Weight:: 50-70 kDa
Physical State:: Lyophilized
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Sequence:: PKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket