Recombinant Human CEACAM3/CD66d Protein

Product Sizes

100 ug

£353.00

RP00517-100UG

500 ug

£1002.00

RP00517-500UG

1000 ug

£1954.00

RP00517-1000UG

About this Product

SKU:: RP00517
Additional Names:: CD66d|CEA|CEACAM3|CGM1
Extra Details:: The human granulocyte-specific receptor carcinoembryonic antigen-related cell adhesion molecule (CEACAM)3 is critically involved in the opsonin-independent recognition of several bacterial pathogens. CEACAM3-mediated phagocytosis depends on the integrity of an ITAM-like sequence within the cytoplasmic domain of CEACAM3 and is characterized by rapid stimulation of the GTPase Rac.
Formulation:: Recombinant Human CEACAM3/CD66d Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys35-Gly155) of Human CEACAM3/CD66d (Accession #P40198-1) fused w
Immunogen:: Lys35-Gly155
Molecular Weight:: 50-60 kDa
Physical State:: Lyophilized
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Sequence:: KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket