Recombinant Human FAM3C Protein
Product Sizes
10 ug
£145.00
RP00514-10UG
50 ug
£336.00
RP00514-50UG
About this Product
- SKU:
- RP00514
- Additional Names:
- FAM3C,GS3786,ILEI
- Extra Details:
- Recombinant Human FAM3C Protein is produced by Human cells expression system. The target protein is expressed with sequence (Gln25-Asp227) of human FAM3C (Accession #Q92520) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2.Contact us for customized product form or formulation.
- Immunogen:
- Gln25-Asp227
- Molecular Weight:
- 23.2 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00514




