Recombinant Human SLAMF1/CD150 Protein
Product Sizes
10 ug
£133.00
RP00510-10UG
20 ug
£181.00
RP00510-20UG
50 ug
£240.00
RP00510-50UG
100 ug
£353.00
RP00510-100UG
500 ug
£1002.00
RP00510-500UG
1000 ug
£1574.00
RP00510-1000UG
About this Product
- SKU:
- RP00510
- Additional Names:
- SLAMF1,CD150,CDw150,SLAM
- Extra Details:
- SLAM-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes ofSLAM signaling are likely to exist: one in which the inhibitor SH2D1A acts as a negative regulator and another inwhich protein-tyrosine phosphatase 2C (PTPN11)-dependent signal transduction operates.
- Formulation:
- Recombinant Human CD150/SLAM Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala21-Pro237) of human CD150/SLAM (Accession #Q13291) fused with a hF
- Immunogen:
- Ala21-Pro237
- Molecular Weight:
- 70-75 kda
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00510
