Recombinant Human FABP3/H-FABP Protein
Product Sizes
10 ug
£133.00
RP00502-10UG
20 ug
£181.00
RP00502-20UG
50 ug
£240.00
RP00502-50UG
100 ug
£353.00
RP00502-100UG
About this Product
- SKU:
- RP00502
- Additional Names:
- FABP3, FABP11, MDGI,Fatty acid-binding protein, heart, Fatty acid-binding protein 3, Heart-type fatty acid-binding protein, H-FABP, Mammary-derived growth inhibitor, MDGI, Muscle fatty acid-binding protein, M-FABP
- Extra Details:
- Recombinant Recombinant Human FABP3/H-FABP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val2-Ala133) of Human FABP3/H-FABP (Accession #NP_004093.1) fused with a His tag at the N-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Val2-Ala133
- Molecular Weight:
- 15.57 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00502
