Biotinylated Recombinant Human HER1/ERBB1/EGFR (25-378) Protein
Product Sizes
100 ug
£657.00
RP00500B-100UG
About this Product
- SKU:
- RP00500B
- Additional Names:
- EC 2.7.10|EC 2.7.10.1|EGFR|ErbB|ERBB1|HER1|LEGFR|mENA|NISBD2|PIG61
- Conjugate:
- Biotin
- Extra Details:
- Biotinylated Recombinant Human ERBB1/HER1/EGFR (25-378) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Ser378) of Human ERBB1/HER1/EGFR (25-378) (Accession #NP_001333870.1) fused with a C-His&Avi tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Leu25-Ser378
- Molecular Weight:
- 41.6 kda
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP00500B
