Biotinylated Recombinant Human ERBB2/HER2/CD340 (489-630) Protein
Product Sizes
100 ug
£657.00
RP00493B-100UG
500 ug
£1954.00
RP00493B-500UG
1000 ug
£3382.00
RP00493B-1000UG
About this Product
- SKU:
- RP00493B
- Additional Names:
- CD340|EGFR2|ENV|ENVW|ErbB2|ERVWE1|HER-2|HER2|herstatin|HERV7Q|HERVW|MLN 19|MLN19|NEU|NGL|TKR1
- Conjugate:
- Biotin
- Extra Details:
- ErbB2, also called Neu and Her2 (human epidermal growth factor receptor 2), is a type I membrane glycoprotein that is a member of the ErbB family of tyrosine kinase receptors. ErbB family members serve as receptors for the epidermal growth factor (EGF) family of growth factors.Upon ERBB2 activation, the MEMO1-RHOA-DIAPH1 signaling pathway elicits the phosphorylation and thus the inhibition of GSK3B at cell membrane. This prevents the phosphorylation of APC and CLASP2, allowing its association with the cell membrane.
- Formulation:
- Biotinylated Recombinant Human ERBB2/HER2/CD340 (489-630) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro489-Cys630) of Human ERBB2/HER2/CD340
- Immunogen:
- Pro489-Cys630
- Molecular Weight:
- 28-40 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- PHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP00493B
