Biotinylated Recombinant Human ERBB2/HER2/CD340 (489-630) Protein

Product Sizes

100 ug

£657.00

RP00493B-100UG

About this Product

SKU:: RP00493B
Additional Names:: CD340|EGFR2|ENV|ENVW|ErbB2|ERVWE1|HER-2|HER2|herstatin|HERV7Q|HERVW|MLN 19|MLN19|NEU|NGL|TKR1
Conjugate:: Biotin
Extra Details:: Biotinylated Recombinant Human ERBB2/HER2/CD340 (489-630) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro489-Cys630) of Human ERBB2/HER2/CD340 (489-630) (Accession #P04626-1) fused with a C-His&Avi tag at the C-terminus.
Formulation:: Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Immunogen:: Pro489-Cys630
Molecular Weight:: 18.5 kDa
Physical State:: Lyophilized
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Sequence:: PHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINC
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes

Basket