Recombinant Human Fc-epsilon RI-alpha/FCER1A Protein
Product Sizes
100 ug
£336.00
RP00489-100UG
About this Product
- SKU:
- RP00489
- Additional Names:
- Fc-epsilon RI-alpha|FCE1A|FCER1A|FcERI
- Extra Details:
- Recombinant Human Fc-epsilon RI-alpha/FCER1A Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val26-Gln205) of Human Fc-epsilon RI-alpha/FCER1A (Accession #P12319-1) fused with a C-hFc tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Val26-Gln205
- Molecular Weight:
- 47.8 kda
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00489
