Recombinant Mouse FGF-1/aFGF Protein
Product Sizes
10 ug
£127.00
RP00487-10UG
20 ug
£157.00
RP00487-20UG
50 ug
£241.00
RP00487-50UG
100 ug
£336.00
RP00487-100UG
500 ug
£1002.00
RP00487-500UG
1000 ug
£1574.00
RP00487-1000UG
About this Product
- SKU:
- RP00487
- Additional Names:
- Fibroblast Growth Factor 1, FGF-1, Acidic Fibroblast Growth Factor, aFGF, Heparin-BindingGrowth Factor 1, HBGF-1, Fgf1, Fgf-1, Fgfa
- Extra Details:
- FGF acidic is a 17 kDa nonglycosylated member of the FGF family of mitogenic peptides. FGF acidic, which isproduced by multiple cell types, stimulates the proliferation of all cells of mesodermal origin and many cells ofneuroectodermal, ectodermal, and endodermal origin. It plays a number of roles in development,regeneration, and angiogenesis. FGF-acidic is a non-glycosylated heparin binding growth factor that isexpressed in the brain, kidney, retina, smooth muscle cells, bone matrix, osteoblasts, astrocytes andendothelial cells. FGF-acidic has the ability to signal through all the FGF receptors.
- Formulation:
- Recombinant Mouse FGF-1/aFGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Phe16-Asp155) of mouse FGF1/FGFa/FGF acidic (Accession #P61148).
- Immunogen:
- Phe16-Asp155
- Molecular Weight:
- 15-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00487
