Recombinant Mouse FGF-1/aFGF Protein
Product Sizes
10 ug
£127.00
RP00487-10UG
20 ug
£157.00
RP00487-20UG
100 ug
£336.00
RP00487-100UG
About this Product
- SKU:
- RP00487
- Additional Names:
- Fibroblast Growth Factor 1, FGF-1, Acidic Fibroblast Growth Factor, aFGF, Heparin-BindingGrowth Factor 1, HBGF-1, Fgf1, Fgf-1, Fgfa
- Extra Details:
- Recombinant Mouse FGF-1/aFGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Phe16-Asp155) of mouse FGF1/FGFa/FGF acidic (Accession #P61148).
- Formulation:
- Lyophilized from a 0.2 um filtered solution of 20 mM Tris-HCl, pH7.5, 50 mM Na2SO4, 0.5 mM DTT, 1 mM EDTA. Contact us for customized product form or formulation.
- Immunogen:
- Phe16-Asp155
- Molecular Weight:
- 15.79 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00487
