Recombinant Human Fc gamma RIIA/FCGR2A/CD32a Protein
Product Sizes
100 ug
£336.00
RP00481-100UG
500 ug
£1002.00
RP00481-500UG
1000 ug
£1764.00
RP00481-1000UG
About this Product
- SKU:
- RP00481
- Additional Names:
- CD32A|Fc gamma RIIA|FCG2|FCGR2|FCGR2A|FCGR2A1|FcgRIIA|fcRII-a|FCRIIA
- Extra Details:
- The Fc gamma Rs have been divided into three classes based on close relationships in their extracellular domains; these groups are designated Fc gamma RI (also known as CD64), Fc gamma RII (CD32), and Fc gamma RIII (CD16). Each group may be encoded by multiple genes and exist in different isoforms depending on species and cell type.
- Formulation:
- Recombinant Human Fc gamma RIIA/FCGR2A/CD32a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala36-Ile218) of Human Fc gamma RIIA/CD32a (Accession
- Immunogen:
- Ala36-Ile218
- Molecular Weight:
- 30-40 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00481
