Recombinant Human Fc gamma RIIA/FCGR2A/CD32a Protein
Product Sizes
100 ug
£336.00
RP00481-100UG
About this Product
- SKU:
- RP00481
- Additional Names:
- CD32A|Fc gamma RIIA|FCG2|FCGR2|FCGR2A|FCGR2A1|FcgRIIA|fcRII-a|FCRIIA
- Extra Details:
- Recombinant Human Fc gamma RIIA/FCGR2A/CD32a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala36-Ile218) of Human Fc gamma RIIA/CD32a (Accession #P12318-1) fused with a C-His&Avi tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Ala36-Ile218
- Molecular Weight:
- 23.2 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00481




