Biotinylated Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein
Product Sizes
100 ug
£657.00
RP00479B-100UG
About this Product
- SKU:
- RP00479B
- Additional Names:
- CD32|CD32A|CD32b|CDw32|Fc gamma RII|Fc gamma RIIB|FCG2|FcGR|FCGR2|FCGR21|FCGR2A|IGFR2
- Conjugate:
- Biotin
- Extra Details:
- Biotinylated Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala46-Pro217) of Human Fc gamma RIIB/CD32b (Accession #P31994-1) fused with a C-His&Avi tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Ala46-Pro217
- Molecular Weight:
- 22.5 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Manufacturer's Data Sheet:RP00479B
