Recombinant Human Fc-gamma RIII alpha/FCGR3A/CD16a (F176V) (107-189) Protein
Product Sizes
100 ug
£395.00
RP00476-100UG
About this Product
- SKU:
- RP00476
- Additional Names:
- CD16|CD16A|Fc gamma RIIIA|FCG3|FCGR3|FCGR3A|FCGRIII|FcgRIIIA|FcR-10|FcRIII|FcRIIIa|IGFR3|IMD20
- Extra Details:
- Recombinant Human Fc-gamma RIII alpha/FCGR3A/CD16a (F176V) (107-189) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly107-Thr189(F176V)) of Human Fc-gamma RIII alpha/FCGR3A/CD16a (F176V) ( 107-189) (Accession #AAH17865) fused with a C-mFc tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Gly107-Thr189 (F176V)
- Molecular Weight:
- 35.29 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- GWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNIT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00476
