Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b (S36R, N82D, I106V) Protein
Product Sizes
100 ug
£353.00
RP00474-100UG
About this Product
- SKU:
- RP00474
- Additional Names:
- CD16|CD16B|CD16b (NA2)|Fc gamma RIIIB|FCG3|FCG3B|FCGR3|FCGR3B|FcgRIIIB|FCR-10|FCRIIIB|IGFR3
- Extra Details:
- Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b (S36R, N82D, I106V) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly17-Ser200) of Human Fc-gamma RIII beta/FCGR3B/CD16b (S36R,N82D,I106V) (Accession #O75015) fused with a C-His tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Gly17-Ser200(NA1)
- Molecular Weight:
- 22.52 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00474




