Biotinylated Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b Protein
Product Sizes
100 ug
£657.00
RP00471B-100UG
500 ug
£1954.00
RP00471B-500UG
1000 ug
£3382.00
RP00471B-1000UG
About this Product
- SKU:
- RP00471B
- Additional Names:
- CD16|CD16B|CD16b (NA2)|Fc gamma RIIIB|FCG3|FCG3B|FCGR3|FCGR3B|FcgRIIIB|FCR-10|FCRIIIB|IGFR3
- Conjugate:
- Biotin
- Extra Details:
- Human Fc gamma RIIIB/CD16b Protein is a receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
- Formulation:
- Biotinylated Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly17-Ser200) of Human Fc-gamma RII
- Immunogen:
- Gly17-Ser200(NA2)
- Molecular Weight:
- 47-53 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Manufacturer's Data Sheet:RP00471B
