Biotinylated Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b Protein

Product Sizes

100 ug

£657.00

RP00471B-100UG

500 ug

£1954.00

RP00471B-500UG

1000 ug

£3382.00

RP00471B-1000UG

About this Product

SKU:: RP00471B
Additional Names:: CD16|CD16B|CD16b (NA2)|Fc gamma RIIIB|FCG3|FCG3B|FCGR3|FCGR3B|FcgRIIIB|FCR-10|FCRIIIB|IGFR3
Conjugate:: Biotin
Extra Details:: Human Fc gamma RIIIB/CD16b Protein is a receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Formulation:: Biotinylated Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly17-Ser200) of Human Fc-gamma RII
Immunogen:: Gly17-Ser200(NA2)
Molecular Weight:: 47-53 kDa
Physical State:: Lyophilized
Purity:: ≥ 95 % as determined by SDS-PAGE;≥ 95 %
Sequence:: GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein

Basket