Recombinant Human TNFRSF25/DR3 Protein
Product Sizes
100 ug
£621.00
RP00464-100UG
About this Product
- SKU:
- RP00464
- Additional Names:
- TNFRSF25,APO-3,DDR3,DR3,LARD,TNFRSF12,TR3,TRAMP,WSL-1,WSL-LR
- Extra Details:
- Recombinant Human TNFRSF25/DR3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gln199) of human TNFRSF25/DR3 (Accession #Q93038) fused with a hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
- Immunogen:
- Met1-Gln199
- Molecular Weight:
- 45.9 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MEQRPRGCAAVAAALLLVLLGARAQGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00464
