Recombinant Human TNFRSF11A/RANK/CD265 Protein
Product Sizes
10 ug
£145.00
RP00458-10UG
50 ug
£288.00
RP00458-50UG
About this Product
- SKU:
- RP00458
- Additional Names:
- TNFRSF11A,CD265,FEO,LOH18CR1,ODFR,OFE,OPTB7,OSTS,PDB2,RANK,TRANCER
- Extra Details:
- Recombinant Human TNFRSF11A/RANK/CD265 Protein is produced by Human Cell expression system. The target protein is expressed with sequence (Ile30-Pro212) of human TNFRSF11A/RANK/CD265 (Accession #Q9Y6Q6) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ile30-Pro212
- Molecular Weight:
- 26.3 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00458
