Biotinylated Recombinant Human HMGB1 Protein (Primary Amine Labeling)
Product Sizes
100 ug
£657.00
RP00455B-100UG
About this Product
- SKU:
- RP00455B
- Additional Names:
- HMG-1|HMG1|HMG3|HMGB1|SBP-1
- Conjugate:
- Biotin
- Extra Details:
- Biotinylated Recombinant Human HMGB1 Protein (Primary Amine Labeling) is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu215) of Human HMGB1 (Primary Amine Labeling) (Accession #P09429-1) fused with a C-His tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Met1-Glu215
- Molecular Weight:
- 26 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Manufacturer's Data Sheet:RP00455B
