Recombinant Human IL-1R1/CD121a Protein
Product Sizes
100 ug
£353.00
RP00453-100UG
500 ug
£1002.00
RP00453-500UG
1000 ug
£1954.00
RP00453-1000UG
About this Product
- SKU:
- RP00453
- Additional Names:
- CD121a|D2S1473|IL-1 RI|IL-1R-1|IL-1R-alpha|IL-1RI|IL-1RT1|IL1R|IL1RA|IL1RI|p80
- Extra Details:
- Interleukin 1 (IL-1) has long been known for its pleiotropic effects on inflammation that plays a complex, and sometimes contrasting, role in different stages of cancer development.IL-1R1 is the main receptor for both ligands and is expressed by various cell types, including innate and adaptive immune cell types, epithelial cells, endothelial cells, adipocytes, chondrocytes, fibroblasts, etc. IL-1 and IL-1R1 receptor interaction leads to a set of common signaling pathways, mainly the NF-kB and MAP kinase pathways, as a result of complex positive and negative regulations.
- Formulation:
- Recombinant Human IL-1R1/ CD121a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu18-Thr332) of Human IL-1R1/ CD121a (Accession #P14778) fused w
- Immunogen:
- Leu18-Thr332
- Molecular Weight:
- 55-68 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00453
