Recombinant Human IL-1R1/CD121a Protein
Product Sizes
100 ug
£395.00
RP00450-100UG
About this Product
- SKU:
- RP00450
- Additional Names:
- CD121a|D2S1473|IL-1 RI|IL-1R-1|IL-1R-alpha|IL-1RI|IL-1RT1|IL1R|IL1RA|IL1RI|p80
- Extra Details:
- Recombinant Human IL-1R1/ CD121a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu18-Thr332) of Human IL-1R1/ CD121a (Accession #P14778) fused with No Tag.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Leu18-Thr332
- Molecular Weight:
- 36.17 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00450
